Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABP1 polyclonal antibody (A01)

  • Catalog # : H00000026-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ABP1.
  • Immunogen:
  • ABP1 (NP_001082, 501 a.a. ~ 599 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000026-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ABP1 polyclonal antibody (A01), Lot # 06198 (060717JCS1). Western Blot analysis of ABP1 expression in human placenta.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 26
  • Gene Name:
  • ABP1
  • Gene Alias:
  • ABP,AOC1,DAO,DAO1,KAO
  • Gene Description:
  • amiloride binding protein 1 (amine oxidase (copper-containing))
  • Gene Summary:
  • This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. [provided by RefSeq
  • Other Designations:
  • amiloride binding protein 1,amiloride-binding protein,amiloride-binding protein-1,amiloride-sensitive amine oxidase,diamine oxidase,histaminase,kidney amine oxidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook