ABCA4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ABCA4.
Immunogen
ABCA4 (NP_000341, 2174 a.a. ~ 2273 a.a) partial recombinant protein with GST tag.
Sequence
PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDLPLHPRAAGASRQAQD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ABCA4 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of ABCA4 expression in SJCRH30 ( Cat # L027V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ABCA4
Entrez GeneID
24GeneBank Accession#
NM_000350Protein Accession#
NP_000341Gene Name
ABCA4
Gene Alias
ABC10, ABCR, ARMD2, CORD3, DKFZp781N1972, FFM, FLJ17534, RMP, RP19, STGD, STGD1
Gene Description
ATP-binding cassette, sub-family A (ABC1), member 4
Gene Ontology
HyperlinkGene Summary
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2. [provided by RefSeq
Other Designations
ATP binding cassette transporter|ATP-binding cassette, sub-family A member 4|ATP-binding transporter, retina-specific|OTTHUMP00000012366|photoreceptor rim protein|retina-specific ABC transporter
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com