Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NAT1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00000009-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NAT1 protein.
  • Immunogen:
  • NAT1 (NP_000653.3, 1 a.a. ~ 290 a.a) full-length human protein.
  • Sequence:
  • MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NAT1 expression in transfected 293T cell line (H00000009-T02) by NAT1 MaxPab polyclonal antibody.

    Lane 1: NAT1 transfected lysate(33.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of NAT1 transfected lysate using anti-NAT1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAT1 purified MaxPab mouse polyclonal antibody (B01P) (H00000009-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9
  • Gene Name:
  • NAT1
  • Gene Alias:
  • AAC1,NATI
  • Gene Description:
  • N-acetyltransferase 1 (arylamine N-acetyltransferase)
  • Gene Summary:
  • This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human geneome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • N-acetyltransferase 1,OTTHUMP00000122488,arylamide acetylase 1 (N-acetyltransferase 1),arylamine N-acetyltransferase 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook