Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

A2M (Human) Recombinant Protein (Q01)

  • Catalog # : H00000002-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human A2M partial ORF ( NP_000005.2, 641 a.a. - 730 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000002-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2
  • Gene Name:
  • A2M
  • Gene Alias:
  • CPAMD5,DKFZp779B086,FWP007,S863-7
  • Gene Description:
  • alpha-2-macroglobulin
  • Gene Summary:
  • Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. [provided by RefSeq
  • Other Designations:
  • -
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook