- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Polyclonal Ab > Human > Others > C10orf67 polyclonal antibody
C10orf67 polyclonal antibody
- Catalog # : PAB23225
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 uL
- USD $ 415
- order now, ship in 5 days
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Rabbit polyclonal antibody raised against recombinant C10orf67.
- Immunogen:
- Recombinant protein corresponding to amino acids of human C10orf67.
- Sequence:
- QLKFEDRLKEESLSLFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKGMYQQFFEVEEENVSLQDASTVKTN
- Host:
- Rabbit
- Reactivity:
- Human
- Form:
- Liquid
- Purification:
- Antigen affinity purification
- Isotype:
- IgG
- Recommend Usage:
- Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
- Storage Buffer:
- In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Storage Instruction:
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
- Note:
- This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
