ABL1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human adrenal gland with ABL1 polyclonal antibody (Cat # PAB22144) shows strong nuclear positivity in cortical cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with ABL1 polyclonal antibody (Cat # PAB22144) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ABL1.
Immunogen
Recombinant protein corresponding to amino acids of human ABL1.
Sequence
PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human adrenal gland with ABL1 polyclonal antibody (Cat # PAB22144) shows strong nuclear positivity in cortical cells.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with ABL1 polyclonal antibody (Cat # PAB22144) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — ABL1
Entrez GeneID
25Protein Accession#
P00519Gene Name
ABL1
Gene Alias
ABL, JTK7, bcr/abl, c-ABL, p150, v-abl
Gene Description
c-abl oncogene 1, receptor tyrosine kinase
Omim ID
189980Gene Ontology
HyperlinkGene Summary
The ABL1 protooncogene encodes a cytoplasmic and nuclear protein tyrosine kinase that has been implicated in processes of cell differentiation, cell division, cell adhesion, and stress response. Activity of c-Abl protein is negatively regulated by its SH3 domain, and deletion of the SH3 domain turns ABL1 into an oncogene. The t(9;22) translocation results in the head-to-tail fusion of the BCR (MIM:151410) and ABL1 genes present in many cases of chronic myelogeneous leukemia. The DNA-binding activity of the ubiquitously expressed ABL1 tyrosine kinase is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function for ABL1. The ABL1 gene is expressed as either a 6- or 7-kb mRNA transcript, with alternatively spliced first exons spliced to the common exons 2-11. [provided by RefSeq
Other Designations
Abelson murine leukemia viral (v-abl) oncogene homolog 1|OTTHUMP00000022375|OTTHUMP00000022376|bcr/c-abl oncogene protein|proto-oncogene tyrosine-protein kinase ABL1|v-abl Abelson murine leukemia viral oncogene homolog 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com