Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Disease
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

IFNA2 polyclonal antibody   

  • Catalog # : PAB18935
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant IFNA2.
  • Immunogen:
  • Recombinant protein corresponding to human IFNA2.
  • Sequence:
  • CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Purification:
  • Protein G purification
  • Recommend Usage:
  • ELISA (1:500-1:1000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 100 uL distilled water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of 300 ng of human IFNA2 protein expressed in E.coli. Using IFNA2 polyclonal antibody (Cat # PAB18935) at 1 : 1,500 dilution.
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3440
  • Gene Name:
  • IFNA2
  • Gene Alias:
  • IFNA,INFA2,MGC125764,MGC125765
  • Gene Description:
  • interferon, alpha 2
  • Other Designations:
  • OTTHUMP00000021143,alpha-2a interferon,interferon alpha 2b,interferon alpha A
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!