Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

IL6 (Human) Recombinant Protein   BioActive

  • Catalog # : P5378
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 10 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human IL6 (P05231, 30 a.a. - 212 a.a.) mature recombinant protein with His tag expressed in Nicotiana benthamiana.
  • Sequence:
  • HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
  • Theoretical MW (kDa):
  • 22.2, 23-24
  • Form:
  • Lyophilized
  • Preparation Method:
  • Non-transgenic plants (Nicotiana benthamiana) expression system
  • Purification:
  • Sequential chromatography (FPLC)
  • Purity:
  • > 97% by SDS-PAGE
  • Endotoxin Level:
  • < 0.04 EU/ug protein
  • Activity:
  • The specific activity is determined by the dose-dependent stimulation of the proliferation of human TF-1 cells (human erytroleukemic indicator cell line). ED50≤ 1 ng/mL.
  • Quality Control Testing:
  • 0.3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P5378
    It has a predicted molecular mass of 22.2 kDa, however as result of potential glycosylation; the recombinant protein could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel.
  • Storage Buffer:
  • Lyophilized from 10 mM Phosphate Potasium buffer, 50 mM NaCl, pH 7. 4
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water containing 0.1% HSA or BSA to a concentration of 50 ng/ul, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot analysis of 300 ng recombinant IL6 prottein.
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3569
  • Gene Name:
  • IL6
  • Gene Alias:
  • BSF2,HGF,HSF,IFNB2,IL-6
  • Gene Description:
  • interleukin 6 (interferon, beta 2)
  • Gene Summary:
  • This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq
  • Other Designations:
  • interleukin 6
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!