Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

PDGFB (Human) Recombinant Protein   BioActive

  • Catalog # : P4572
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 10 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human PDGFB (P01127) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT
  • Theoretical MW (kDa):
  • 24.3
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.01 ng/ug or < 0.1 EU/ug.
  • Activity:
  • The activity is determined by the dose-dependent proliferation of 3T3 indicator cells. The expected ED50 for this effect is 1.5-2.2 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4572
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized with 10 mM acetic acid.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of human PDGFB, starting at 100 ng/mL, were added to 3T3 cells. Cell proliferation was measured after 46 hours and the linear portion of the curve was us used to calculate the ED50.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5155
  • Gene Name:
  • PDGFB
  • Gene Alias:
  • FLJ12858,PDGF2,SIS,SSV,c-sis
  • Gene Description:
  • platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF, B chain,Platelet-derived growth factor, beta polypeptide (oncogene SIS),becaplermin,oncogene SIS,platelet-derived growth factor 2,platelet-derived growth factor beta,platelet-derived growth factor, B chain,v-sis platelet-derived growth factor beta p
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!