CCL13 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Lane 1: non-reducing conditions
Lane 2: reducing conditions
Result of activity analysis
Result of activity analysis
Human THP-1 cells were allowed to migrate to human CCL13 at (0, 0.1, 1, 10, 100 and 1000 ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.
-
Specification
Product Description
Human CCL13 (Q99616) recombinant protein expressed in Escherichia coli.
Sequence
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Host
Escherichia coli
Theoretical MW (kDa)
8.5
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the ability of MCP-4 to chemoattract human THP-1 cells and is detectable starting at 1 ug/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
No additive
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — CCL13
Entrez GeneID
6357Protein Accession#
Q99616Gene Name
CCL13
Gene Alias
CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1
Gene Description
chemokine (C-C motif) ligand 13
Omim ID
601391Gene Ontology
HyperlinkGene Summary
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq
Other Designations
CK-beta-10|monocyte chemoattractant protein 4|monocyte chemotactic protein 4|new CC chemokine 1|small inducible cytokine A13|small inducible cytokine subfamily A (Cys-Cys), member 13
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com