Product Browser

Last updated: 2014/11/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL6 (Human) Recombinant ProteinBioActive

  • Catalog # : P4416
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL6 (P05231) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependant stimulation of mouse 7TD1 cells and is typcially less than 1 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4416
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM acetic acid
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 10 mM HCl, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3569
  • Gene Name:
  • IL6
  • Gene Alias:
  • BSF2,HGF,HSF,IFNB2,IL-6
  • Gene Description:
  • interleukin 6 (interferon, beta 2)
  • Gene Summary:
  • This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq
  • Other Designations:
  • interleukin 6
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook