- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Bioactive > Cell Cycle > BTC (Human) Recombinant Protein
BTC (Human) Recombinant Protein 
- Catalog # : P4153
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 20 ug
- USD $ 415
- order now, ship in 5 days
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Human BTC (P35070, 80 amino acids) partial recombinant protein expressed in Escherichia coli.
- Sequence:
- DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
- Theoretical MW (kDa):
- 9
- Form:
- Lyophilized
- Preparation Method:
- Escherichia coli expression system
- Purity:
- ≥ 97% by SDS-PAGE and HPLC
- Activity:
- The ED50 calculated by the dose-dependant proliferation of murine BALBC 3T3 cells (measured by 3H-thymidine uptake) is < 0.05 ng/mL; corresponding to a specific activity of > 2.0 x 107 IU/mg.
- Storage Buffer:
- Lyophilized from 20 mM phosphate buffer, pH 7.4
- Storage Instruction:
- Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
- Application Image
- Functional Study
- SDS-PAGE
- Entrez GeneID:
- 685
- Protein Accession#:
- P35070
- Gene Name:
- BTC
- Gene Alias:
- -
- Gene Description:
- betacellulin
- Omim ID:
- 600345
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. [provided by RefSeq
- Other Designations:
- OTTHUMP00000160600
- Interactome
- Gene Pathway
