Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

FLT1 (Human) Recombinant Protein   

  • Catalog # : P3832
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 10 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human FLT1 (NP_002010.1, 31 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 10% SDS-PAGE Result

    QC Testing of P3832
  • Storage Buffer:
  • In saline or Tris (50% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • SDS-PAGE
  • Application Image
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2321
  • Gene Name:
  • FLT1
  • Gene Alias:
  • FLT,VEGFR1
  • Gene Description:
  • fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
  • Gene Summary:
  • This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia
  • Other Designations:
  • fms-related tyrosine kinase 1,soluble VEGF receptor 1-14,soluble VEGFR1 variant 2,soluble VEGFR1 variant 21,vascular endothelial growth factor/vascular permeability factor receptor
  • Interactome
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!