Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

PDGFB (Human) Recombinant Protein   BioActive

  • Catalog # : P3661
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 10 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris.
  • Sequence:
  • SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
  • Theoretical MW (kDa):
  • 32 (non-reducing con
  • Form:
  • Lyophilized
  • Preparation Method:
  • Pichia pastoris expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 98% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of Balb/c 3T3 cells.The expected ED50 for this effect is 1.0-3.0 ng/mL, corresponding to 1 x 106 IU/mg.
  • Storage Buffer:
  • Lyophilized from 0.02 M acetic acid, pH 6.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5155
  • Gene Name:
  • PDGFB
  • Gene Alias:
  • FLJ12858,PDGF2,SIS,SSV,c-sis
  • Gene Description:
  • platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF, B chain,Platelet-derived growth factor, beta polypeptide (oncogene SIS),becaplermin,oncogene SIS,platelet-derived growth factor 2,platelet-derived growth factor beta,platelet-derived growth factor, B chain,v-sis platelet-derived growth factor beta p
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!