Product Browser

Last updated: 2014/8/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3615
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 97% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by the ability to chemoattract human neutrophils using a concentration range of 10.0-50.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 40 mM NaCl, 10 mM PB, pH 7.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2919
  • Gene Name:
  • CXCL1
  • Gene Alias:
  • FSP,GRO1,GROa,MGSA,MGSA-a,NAP-3,SCYB1
  • Gene Description:
  • chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
  • Gene Summary:
  • Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif. ELR types are chemotactic for neutrophils, while non-ELR types are chemotactic for lymphocytes.[supplied by OMIM
  • Other Designations:
  • GRO1 oncogene (melanoma growth stimulating activity, alpha),GRO1 oncogene (melanoma growth-stimulating activity),MGSA alpha,chemokine (C-X-C motif) ligand 1,fibroblast secretory protein,melanoma growth stimulatory activity alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook