GSTK1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GSTK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTK1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of GSTK1 expression in transfected 293T cell line (H00373156-T03) by GSTK1 MaxPab polyclonal antibody.
Lane 1: GSTK1 transfected lysate(25.50 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of GSTK1 transfected lysate using anti-GSTK1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTK1 purified MaxPab mouse polyclonal antibody (B02P) (H00373156-B02P).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GSTK1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTK1 protein.
Immunogen
GSTK1 (NP_057001.1, 1 a.a. ~ 226 a.a) full-length human protein.
Sequence
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTK1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of GSTK1 expression in transfected 293T cell line (H00373156-T03) by GSTK1 MaxPab polyclonal antibody.
Lane 1: GSTK1 transfected lysate(25.50 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of GSTK1 transfected lysate using anti-GSTK1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTK1 purified MaxPab mouse polyclonal antibody (B02P) (H00373156-B02P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GSTK1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GSTK1
Entrez GeneID
373156GeneBank Accession#
NM_015917.1Protein Accession#
NP_057001.1Gene Name
GSTK1
Gene Alias
GST, GST13, GST13-13, GSTK1-1
Gene Description
glutathione S-transferase kappa 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants
Other Designations
GST class-kappa|glutathione S-transferase k1|glutathione S-transferase subunit 13 homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com