ATP6V1C2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ATP6V1C2 MaxPab polyclonal antibody. Western Blot analysis of ATP6V1C2 expression in JAR.
Western Blot (Transfected lysate)
Western Blot analysis of ATP6V1C2 expression in transfected 293T cell line (H00245973-T01) by ATP6V1C2 MaxPab polyclonal antibody.
Lane 1: ATP6V1C2 transfected lysate(41.91 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ATP6V1C2 protein.
Immunogen
ATP6V1C2 (AAH12142.1, 1 a.a. ~ 381 a.a) full-length human protein.
Sequence
MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP6V1C2 MaxPab polyclonal antibody. Western Blot analysis of ATP6V1C2 expression in JAR.Western Blot (Transfected lysate)
Western Blot analysis of ATP6V1C2 expression in transfected 293T cell line (H00245973-T01) by ATP6V1C2 MaxPab polyclonal antibody.
Lane 1: ATP6V1C2 transfected lysate(41.91 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP6V1C2
Entrez GeneID
245973GeneBank Accession#
BC012142.1Protein Accession#
AAH12142.1Gene Name
ATP6V1C2
Gene Alias
ATP6C2, VMA5
Gene Description
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal 42kD, V1 subunit C|OTTHUMP00000115522|V-ATPase C2 subunit|vacuolar H+ ATPase C2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com