MYL6B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MYL6B protein.
Immunogen
MYL6B (NP_002466.1, 1 a.a. ~ 208 a.a) full-length human protein.
Sequence
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MYL6B MaxPab rabbit polyclonal antibody. Western Blot analysis of MYL6B expression in mouse testis.Western Blot (Transfected lysate)
Western Blot analysis of MYL6B expression in transfected 293T cell line (H00140465-T02) by MYL6B MaxPab polyclonal antibody.
Lane 1: MYL6B transfected lysate(22.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MYL6B
Entrez GeneID
140465GeneBank Accession#
NM_002475Protein Accession#
NP_002466.1Gene Name
MYL6B
Gene Alias
MLC1SA
Gene Description
myosin, light chain 6B, alkali, smooth muscle and non-muscle
Omim ID
609930Gene Ontology
HyperlinkGene Summary
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq
Other Designations
myosin alkali light chain 1 slow a|myosin light chain 1 slow a|myosin light chain 1, slow-twitch muscle A isoform|myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle|smooth muscle and non-muscle myosin alkali light chain 6B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com