STARD4 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of STARD4 expression in transfected 293T cell line (H00134429-T01) by STARD4 MaxPab polyclonal antibody.
Lane 1: STARD4 transfected lysate(22.55 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human STARD4 protein.
Immunogen
STARD4 (NP_631903.1, 1 a.a. ~ 205 a.a) full-length human protein.
Sequence
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of STARD4 expression in transfected 293T cell line (H00134429-T01) by STARD4 MaxPab polyclonal antibody.
Lane 1: STARD4 transfected lysate(22.55 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — STARD4
Entrez GeneID
134429GeneBank Accession#
NM_139164Protein Accession#
NP_631903.1Gene Name
STARD4
Gene Alias
-
Gene Description
StAR-related lipid transfer (START) domain containing 4
Omim ID
607049Gene Ontology
HyperlinkGene Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM
Other Designations
START domain containing 4 sterol-regulated|START domain containing 4, sterol regulated
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com