TBN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TBN protein.
Immunogen
TBN (AAH33728.1, 1 a.a. ~ 174 a.a) full-length human protein.
Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TAF8 expression in transfected 293T cell line (H00129685-T02) by TAF8 MaxPab polyclonal antibody.
Lane 1: TBN transfected lysate(19.14 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TAF8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TAF8
Entrez GeneID
129685GeneBank Accession#
BC033728Protein Accession#
AAH33728.1Gene Name
TAF8
Gene Alias
43, FLJ32821, II, TAF, TAFII43, TBN
Gene Description
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Omim ID
609514Gene Ontology
HyperlinkGene Summary
This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000016392|TAF(II)43|TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa|TBP-associated factor 8|TBP-associated factor TAFII43|TBP-associa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com