SENP8 monoclonal antibody (M06), clone 2E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SENP8.
Immunogen
SENP8 (NP_660205, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SENP8 expression in transfected 293T cell line by SENP8 monoclonal antibody (M06), clone 2E1.
Lane 1: SENP8 transfected lysate(24.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SENP8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SENP8
Entrez GeneID
123228GeneBank Accession#
NM_145204Protein Accession#
NP_660205Gene Name
SENP8
Gene Alias
DEN1, HsT17512, NEDP1, PRSC2
Gene Description
SUMO/sentrin specific peptidase family member 8
Omim ID
608659Gene Ontology
HyperlinkGene Summary
NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM
Other Designations
NEDD8-specific protease 1|SUMO/sentrin specific protease family member 8|deneddylase 1|protease, cysteine, 2 (NEDD8 specific)|sentrin/SUMO-specific protease SENP8
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com