NEDD1 monoclonal antibody (M05), clone 7D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEDD1.
Immunogen
NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.75 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEDD1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NEDD1
-
Interactome
-
Publication Reference
-
NEDD1-S411 phosphorylation plays a critical function in the coordination of microtubule nucleation during mitosis.
Krystal Timón Pérez, Jacopo Scrofani, Isabelle Vernos.
Biology Open 2022 Oct; bio.059474.
Application:IF, WB-Ce, WB-Tr, Human, HeLa cells.
-
Dual spindles assemble in bovine zygotes despite the presence of paternal centrosomes.
Isabell Schneider, Marta de Ruijter-Villani, M Julius Hossain, Tom A E Stout, Jan Ellenberg.
The Journal of Cell Biology 2021 Nov; 220(11):e202010106.
Application:IF, Bovine, Bovine embryos, bovine zygotes.
-
Loss of aMTOCs disrupts spindle pole Aurora A and assembly of the liquid-like meiotic spindle domain (LISD) in oocytes.
Xiaotian Wang, Claudia Baumann, Rabindranath De La Fuente, Maria M Viveiros.
Journal of Cell Science 2021 Jul; 134(14):jcs256297.
Application:IF, Mouse, Mouse Oocytes.
-
A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes.
So C, Seres KB, Steyer AM, Mönnich E, Clift D, Pejkovska A, Möbius W, Schuh M.
Science 2019 Jun; 364(6447):eaat9557.
Application:IF, Bovine, Mouse, Ovine, Pig, NIH/3T3 cells, Oocytes.
-
Control of endothelial cell polarity and sprouting angiogenesis by non-centrosomal microtubules.
Martin M, Veloso A, Wu J, Katrukha EA, Akhmanova A.
Elife 2018 Mar; 7:e33864.
Application:IF, Human, HUVECs.
-
Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission.
Uehara R, Kamasaki T, Hiruma S, Poser I, Yoda K, Yajima J, Gerlich DW, Goshima G.
Molecular Biology of the Cell 2016 Mar; 27(5):812.
Application:Immunoblotting, Human, HeLa cells.
-
The dynamics of microtubule minus ends in the human mitotic spindle.
Lecland N, Luders J.
Nature Cell Biology 2014 Aug; 16(8):770.
Application:IF, Human, HeLa cells.
-
Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase.
Uehara R, Goshima G.
The Journal of Cell Biology 2010 Oct; 191(2):259.
Application:WB-Tr, Human, HeLa cells.
-
The {gamma}TuRC Revisited: A Comparative Analysis of Interphase and Mitotic Human {gamma}TuRC Redefines the Set of Core Components and Identifies the Novel Subunit GCP8.
Teixido-Travesa N, Villen J, Lacasa C, Bertran MT, ArchintiM, Gygi SP, Caelles C, Roig J, Luders J.
Molecular Biology of the Cell 2010 Nov; 21(22):3963.
Application:WB-Tr, Human, U2OS cells.
-
SPICE - a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression.
Archinti M, Lacasa C, Teixido-Travesa N, Luders J.
Journal of Cell Science 2010 Sep; 123(Pt 18):3039.
Application:IF, Human, HeLa cells.
-
Axon Extension Occurs Independently of Centrosomal Microtubule Nucleation.
Stiess M, Maghelli N, Kapitein LC, Gomis-Ruth S, Wilsch-Brauninger M, Hoogenraad CC, Tolic-Norrelykke IM, Bradke F.
Science 2010 Feb; 327(5966):704.
Application:WB, Rat, Rat hippocampal neurons.
-
FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle and the centrosomes.
Zhu H, Fang K, Fang G.
Journal of Cell Science 2009 Aug; 122(Pt 15):2750.
Application:IF, WB-Ce, WB-Tr, Human, HeLa, HeLa S3 cells.
-
Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components.
Haren L, Stearns T, Luders J.
PLoS One 2009 Jun; 4(6):e5976.
Application:IF, Human, HeLa cells.
-
FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
Zhu H, Coppinger JA, Jang CY, Yates JR, III, Fang J.
Journal of Cellular Biology 2008 Nov; 183(5):835.
Application:IF, WB, Human, HeLa cells.
-
NEDD1-S411 phosphorylation plays a critical function in the coordination of microtubule nucleation during mitosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com