SLAMF6 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SLAMF6 MaxPab polyclonal antibody. Western Blot analysis of SLAMF6 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of SLAMF6 expression in transfected 293T cell line (H00114836-T01) by SLAMF6 MaxPab polyclonal antibody.
Lane 1: SLAMF6 transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SLAMF6 protein.
Immunogen
SLAMF6 (AAH90928.1, 1 a.a. ~ 271 a.a) full-length human protein.
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
SLAMF6 MaxPab polyclonal antibody. Western Blot analysis of SLAMF6 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of SLAMF6 expression in transfected 293T cell line (H00114836-T01) by SLAMF6 MaxPab polyclonal antibody.
Lane 1: SLAMF6 transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SLAMF6
Entrez GeneID
114836GeneBank Accession#
BC090928.1Protein Accession#
AAH90928.1Gene Name
SLAMF6
Gene Alias
KALI, KALIb, Ly108, MGC104953, NTB-A, NTBA, SF2000
Gene Description
SLAM family member 6
Omim ID
606446Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. [provided by RefSeq
Other Designations
NTBA receptor|OTTHUMP00000024348|activating NK receptor|natural killer-, T- and B-cell antigen
-
Interactome
-
Disease
-
Publication Reference
-
The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling.
Proust R, Bertoglio J, Gesbert F.
PLoS One 2012 Aug; 7(8):e43200.
Application：WB, Human, Jurkat cells.
-
The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com