KRT71 monoclonal antibody (M02), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KRT71 expression in transfected 293T cell line by KRT71 monoclonal antibody (M02), clone 1D4.
Lane 1: KRT71 transfected lysate (Predicted MW: 57.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KRT71 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.76 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KRT71.
Immunogen
KRT71 (NP_258259.1, 251 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KRT71 expression in transfected 293T cell line by KRT71 monoclonal antibody (M02), clone 1D4.
Lane 1: KRT71 transfected lysate (Predicted MW: 57.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KRT71 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — KRT71
Entrez GeneID
112802GeneBank Accession#
NM_033448Protein Accession#
NP_258259.1Gene Name
KRT71
Gene Alias
K6IRS1, KRT6IRS, KRT6IRS1, MGC119390, MGC119391
Gene Description
keratin 71
Omim ID
608245Gene Ontology
HyperlinkGene Summary
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13
Other Designations
keratin 6 irs
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com