IL17F purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IL17F protein.
Immunogen
IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein.
Sequence
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL17F expression in transfected 293T cell line (H00112744-T01) by IL17F MaxPab polyclonal antibody.
Lane 1: IL17F transfected lysate(17.93 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to IL17F on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] -
Gene Info — IL17F
Entrez GeneID
112744GeneBank Accession#
NM_052872Protein Accession#
NP_443104.1Gene Name
IL17F
Gene Alias
IL-17F, ML-1, ML1
Gene Description
interleukin 17F
Omim ID
606496Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq
Other Designations
cytokine ML-1
-
Interactome
-
Disease
- Arthritis
- Asthma
- Behcet Syndrome
- Cardiovascular Diseases
- Colitis
- Crohn Disease
- Dermatitis
- Diabetes Mellitus
- Dyspepsia
+ View More Disease
-
Publication Reference
-
Verification of IL-17A and IL-17F in oral tissues and modulation of their expression pattern by steroid hormones.
Konermann A, Winter J, Novak N, Allam JP, Jager A.
Cellular Immunology 2013 Sep; 285(1-2):133.
Application:IHC, Human, Alveolar bone, Healthy gingiva, Periodontal tissue.
-
Intratumoral regulatory T cells as an independent predictive factor for pathological complete response to neoadjuvant paclitaxel followed by 5-FU/epirubicin/cyclophosphamide in breast cancer patients.
Oda N, Shimazu K, Naoi Y, Morimoto K, Shimomura A, Shimoda M, Kagara N, Maruyama N, Kim SJ, Noguchi S.
Breast Cancer Research and Treatment 2012 Nov; 136(1):107.
Application:IHC-P, Human, Human breast cancer.
-
Verification of IL-17A and IL-17F in oral tissues and modulation of their expression pattern by steroid hormones.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com