DEPDC7 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DEPDC7 protein.
Immunogen
DEPDC7 (AAH30970.1, 1 a.a. ~ 511 a.a) full-length human protein.
Sequence
MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DEPDC7 MaxPab polyclonal antibody. Western Blot analysis of DEPDC7 expression in NIH/3T3.Western Blot (Cell lysate)
DEPDC7 MaxPab polyclonal antibody. Western Blot analysis of DEPDC7 expression in PC-12.Western Blot (Cell lysate)
DEPDC7 MaxPab polyclonal antibody. Western Blot analysis of DEPDC7 expression in HepG2.Western Blot (Cell lysate)
DEPDC7 MaxPab polyclonal antibody. Western Blot analysis of DEPDC7 expression in Hela S3 NE.Western Blot (Cell lysate)
DEPDC7 MaxPab polyclonal antibody. Western Blot analysis of DEPDC7 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of DEPDC7 expression in transfected 293T cell line (H00091614-T01) by DEPDC7 MaxPab polyclonal antibody.
Lane 1: LOC91614 transfected lysate(56.21 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DEPDC7
Entrez GeneID
91614GeneBank Accession#
BC030970Protein Accession#
AAH30970.1Gene Name
DEPDC7
Gene Alias
TR2, dJ85M6.4
Gene Description
DEP domain containing 7
Gene Ontology
HyperlinkOther Designations
dJ85M6.4 (novel 58.3 KDA protein)|novel 58.3 KDA protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com