LHX4 monoclonal antibody (M05), clone 4D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LHX4.
Immunogen
LHX4 (NP_203129, 208 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LHX4 monoclonal antibody (M05), clone 4D7. Western Blot analysis of LHX4 expression in human colon.Western Blot (Tissue lysate)
LHX4 monoclonal antibody (M05), clone 4D7. Western Blot analysis of LHX4 expression in human skeletal muscle.Western Blot (Cell lysate)
LHX4 monoclonal antibody (M05), clone 4D7. Western Blot analysis of LHX4 expression in LNCaP(Cat # L004V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LHX4 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — LHX4
Entrez GeneID
89884GeneBank Accession#
NM_033343Protein Accession#
NP_203129Gene Name
LHX4
Gene Alias
Gsh-4, Gsh4
Gene Description
LIM homeobox 4
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of the pituitary gland. Mutations in this gene are associated with syndromic short stature and pituitary and hindbrain defects. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq
Other Designations
LIM homeobox protein 4|OTTHUMP00000033083
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com