PCGF1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PCGF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of PCGF1 expression in transfected 293T cell line (H00084759-T03) by PCGF1 MaxPab polyclonal antibody.
Lane 1: PCGF1 transfected lysate(29.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PCGF1 protein.
Immunogen
PCGF1 (AAH04952.1, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCGF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of PCGF1 expression in transfected 293T cell line (H00084759-T03) by PCGF1 MaxPab polyclonal antibody.
Lane 1: PCGF1 transfected lysate(29.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PCGF1
Entrez GeneID
84759GeneBank Accession#
BC004952.1Protein Accession#
AAH04952.1Gene Name
PCGF1
Gene Alias
2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68
Gene Description
polycomb group ring finger 1
Gene Ontology
HyperlinkGene Summary
PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM
Other Designations
OTTHUMP00000160412
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com