COX4I2 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant COX4I2.
Immunogen
COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (72); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.98 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COX4I2 monoclonal antibody (M01), clone 1F2. Western Blot analysis of COX4I2 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody (M01), clone 1F2.
Lane 1: COX4I2 transfected lysate (Predicted MW: 20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX4I2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — COX4I2
Entrez GeneID
84701GeneBank Accession#
NM_032609Protein Accession#
NP_115998Gene Name
COX4I2
Gene Alias
COX4, COX4-2, COX4B, COX4L2, COXIV-2, dJ857M17.2
Gene Description
cytochrome c oxidase subunit IV isoform 2 (lung)
Omim ID
607976Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq
Other Designations
OTTHUMP00000030533|cytochrome c oxidase subunit IV isoform 2|cytochrome c oxidase subunit IV-like 2
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Upregulation of COX4-2 via HIF-1α in Mitochondrial COX4-1 Deficiency.
Liza Douiev, Chaya Miller, Shmuel Ruppo, Hadar Benyamini, Bassam Abu-Libdeh, Ann Saada.
Cells 2021 Feb; 10(2):452.
Application:IF, Human, Human foreskin fibroblasts.
-
Cytochrome c Oxidase Subunit 4 Isoform Exchange Results in Modulation of Oxygen Affinity.
Pajuelo Reguera D, Čunátová K, Vrbacký M, Pecinová A, Houštěk J, Mráček T, Pecina P.
Cells 2020 Feb; 9(2):E443.
Application:WB, Human, HEK 293 cell.
-
The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction.
Purandare N, Somayajulu M, Hüttemann M, Grossman LI, Aras S.
The Journal of Biological Chemistry 2018 Apr; 293(17):6517.
Application:Immunoblotting, Human, HEK 293, Hela cells.
-
Control of human energy expenditure by cytochrome c oxidase subunit IV-2.
Schiffer TA, Peleli M, Sundqvist ML, Ekblom B, Lundberg JO, Weitzberg E, Larsen FJ.
American Journal of Physiology. Cell Physiology 2016 Jul; 311(3):C452.
Application:WB, Human, Muscle tissue and human primary myotubes.
-
Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.
Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI.
Nucleic Acids Research 2013 Jan; 41(4):2255.
Application:WB, Rat, Rat primary lung cell.
-
Cytochrome c oxidase subunit 4 isoform 2-knockout mice show reduced enzyme activity, airway hyporeactivity, and lung pathology.
Hüttemann M, Lee I, Gao X, Pecina P, Pecinova A, Liu J, Aras S, Sommer N, Sanderson TH, Tost M, Neff F, Aguilar-Pimentel JA, Becker L, Naton B, Rathkolb B, Rozman J, Favor J, Hans W, Prehn C, Puk O, Schrewe A, Sun M, Höfler H, Adamski J, Bekeredjian R, Graw J, Adler T, Busch DH, Klingenspor M, Klopstock T, Ollert M, Wolf E, Fuchs H, Gailus-Durner V, Hrabě de Angelis M, Weissmann N, Doan JW, Bassett DJ, Grossman LI.
FASEB Journal 2012 Sep; 26(9):3916.
Application:WB-Ti, Bovine, Mouse, Heart, Liver, Lung.
-
Sex- and brain region-specific role of cytochrome c oxidase in 1-methyl-4-phenylpyridinium-mediated astrocyte vulnerability.
Sundar Boyalla S, Barbara Victor M, Roemgens A, Beyer C, Arnold S.
J Neurosci Res 2011 May; 89:2068.
Application:WB-Ce, WB-Ti, Human, Astrocytes, Cortex.
-
Brain region-specific vulnerability of astrocytes in response to 3-nitropropionic acid is mediated by cytochrome c oxidase isoform expression.
Misiak M, Singh S, Drewlo S, Beyer C, Arnold S.
Cell and Tissue Research 2010 Jul; 341(1):83.
Application:WB, Mouse, Mouse astrocytes.
-
Brain region specificity of 3-nitropropionic acid-induced vulnerability of neurons involves cytochrome c oxidase.
Singh S, Misiak M, Beyer C, Arnold S.
Neurochemistry International 2010 Oct; 57(3):297.
Application:WB, Mouse, Primary neurons were prepared from striatum and cortex of BALB/c mouse brains.
-
Upregulation of COX4-2 via HIF-1α in Mitochondrial COX4-1 Deficiency.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com