COX4I2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of COX4I2 expression in transfected 293T cell line (H00084701-T02) by COX4I2 MaxPab polyclonal antibody.
Lane 1: COX4I2 transfected lysate(20.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human COX4I2 protein.
Immunogen
COX4I2 (NP_115998.2, 1 a.a. ~ 171 a.a) full-length human protein.
Sequence
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (71)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COX4I2 expression in transfected 293T cell line (H00084701-T02) by COX4I2 MaxPab polyclonal antibody.
Lane 1: COX4I2 transfected lysate(20.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COX4I2
Entrez GeneID
84701GeneBank Accession#
NM_032609.2Protein Accession#
NP_115998.2Gene Name
COX4I2
Gene Alias
COX4, COX4-2, COX4B, COX4L2, COXIV-2, dJ857M17.2
Gene Description
cytochrome c oxidase subunit IV isoform 2 (lung)
Omim ID
607976Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq
Other Designations
OTTHUMP00000030533|cytochrome c oxidase subunit IV isoform 2|cytochrome c oxidase subunit IV-like 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com