MAP1LC3A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MAP1LC3A full-length ORF ( AAH15810.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.94
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAP1LC3A
Entrez GeneID
84557GeneBank Accession#
BC015810.1Protein Accession#
AAH15810.1Gene Name
MAP1LC3A
Gene Alias
LC3, LC3A, MAP1ALC3, MAP1BLC3
Gene Description
microtubule-associated protein 1 light chain 3 alpha
Omim ID
601242Gene Ontology
HyperlinkGene Summary
MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
MAP1 light chain 3-like protein 1|MAP1A/1B light chain 3 A|MAP1A/MAP1B LC3 A|OTTHUMP00000030696|OTTHUMP00000030697|OTTHUMP00000030698|microtubule-associated proteins 1A/1B light chain 3
-
Interactome
-
Publication Reference
-
Co-chaperone BAG3 enters autophagic pathway via its interaction with microtubule associated protein 1 light chain 3 beta.
Hagen Körschgen, Marius Baeken, Daniel Schmitt, Heike Nagel, Christian Behl.
Traffic (Copenhagen, Denmark) 2023 Sep; [Epub].
Application:Array, N/A, Oligopeptides.
-
Prospective neoadjuvant analysis of PET imaging and mechanisms of resistance to Trastuzumab shows role of HIF1 and autophagy.
Koukourakis MI, Giatromanolaki A, Bottini A, Cappelletti MR, Zanotti L, Allevi G, Strina C, Ardine M, Milani M, Brugnoli G, Martinotti M, Ferrero G, Bertoni R, Ferrozzi F, Harris AL, Generali D.
British Journal of Cancer 2014 Apr; 110(9):2209.
Application:IHC-P, Human, Breast cancer.
-
LC3 immunostaining pitfalls.
Koukourakis MI, Giatromanolaki A, Zois CE, Sivridis E.
Histopathology 2013 May; 62(6):962.
Application:WB, Antibody.
-
Immunohistochemical analysis of macroautophagy: recommendations and limitations.
Martinet W, Schrijvers DM, Timmermans JP, Bult H, De Meyer GR.
Autophagy 2013 Mar; 9(3):386.
Application:WB-Re, Antibody testing.
-
Co-chaperone BAG3 enters autophagic pathway via its interaction with microtubule associated protein 1 light chain 3 beta.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com