Product Browser
 
  • Related Product Showcase
  • By Research Area
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

MAP1LC3A polyclonal antibody (A01)   

  • Catalog # : H00084557-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAP1LC3A.
  • Immunogen:
  • MAP1LC3A (NP_115903, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084557-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MAP1LC3A
  • Gene Alias:
  • LC3,LC3A,MAP1ALC3,MAP1BLC3
  • Gene Description:
  • microtubule-associated protein 1 light chain 3 alpha
  • Gene Summary:
  • MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • MAP1 light chain 3-like protein 1,MAP1A/1B light chain 3 A,MAP1A/MAP1B LC3 A,OTTHUMP00000030696,OTTHUMP00000030697,OTTHUMP00000030698,microtubule-associated proteins 1A/1B light chain 3
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!