COG8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of COG8 expression in transfected 293T cell line by COG8 MaxPab polyclonal antibody.
Lane 1: COG8 transfected lysate(24.09 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COG8 protein.
Immunogen
COG8 (AAH17492, 1 a.a. ~ 219 a.a) full-length human protein.
Sequence
MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COG8 expression in transfected 293T cell line by COG8 MaxPab polyclonal antibody.
Lane 1: COG8 transfected lysate(24.09 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COG8
Entrez GeneID
84342GeneBank Accession#
BC017492Protein Accession#
AAH17492Gene Name
COG8
Gene Alias
DOR1, FLJ22315
Gene Description
component of oligomeric golgi complex 8
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq
Other Designations
conserved oligomeric golgi complex component 8|dependent on RIC1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com