C17orf37 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody.
Lane 1: C17orf37 transfected lysate(12.65 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
Immunogen
C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length human protein.
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody.
Lane 1: C17orf37 transfected lysate(12.65 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C17orf37
Entrez GeneID
84299GeneBank Accession#
NM_032339.3Protein Accession#
NP_115715.3Gene Name
C17orf37
Gene Alias
C35, MGC14832, ORB3, RDX12, XTP4
Gene Description
chromosome 17 open reading frame 37
Gene Ontology
HyperlinkOther Designations
hypothetical protein LOC84299
-
Interactome
-
Disease
-
Publication Reference
-
MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
Rajendiran S, Parwani AV, Hare RJ, Dasgupta S, Roby RK, Vishwanatha JK.
Molecular Cancer 2014 Nov; 13(1):250.
Application：WB, Human, DU-145, PWR-1E cells.
-
Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
Dasgupta S, Wasson LM, Rauniyar N, Prokai L, Borejdo J, Vishwanatha JK.
Oncogene 2009 Aug; 28(32):2860.
Application：IHC, IF, WB-Ce, WB-Tr, Human, DU-145, PC-3, LNC4-2, LNCaP-UR, LNCaP-RF, LNCaP-R, HPV18 C-1, PWR-1E cells, Prostate.
-
MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com