POLR1B monoclonal antibody (M10), clone 4H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POLR1B.
Immunogen
POLR1B (NP_061887, 963 a.a. ~ 1072 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR1B expression in transfected 293T cell line by POLR1B monoclonal antibody (M10), clone 4H6.
Lane 1: POLR1B transfected lysate (Predicted MW: 128.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR1B is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to POLR1B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — POLR1B
Entrez GeneID
84172GeneBank Accession#
NM_019014Protein Accession#
NP_061887Gene Name
POLR1B
Gene Alias
FLJ10816, FLJ21921, MGC131780, RPA135, RPA2, Rpo1-2
Gene Description
polymerase (RNA) I polypeptide B, 128kDa
Omim ID
602000Gene Ontology
HyperlinkGene Summary
Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).[supplied by OMIM
Other Designations
DNA-directed RNA polymerase I 135kDa polypeptide|RNA polymerase I polypeptide B|RNA polymerase I subunit 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com