Product Browser

Last updated: 2014/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIGD6 (Human) Recombinant Protein (P01)

  • Catalog # : H00081789-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIGD6 full-length ORF ( CAL38628.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.81
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TIGD6
  • Gene Alias:
  • DKFZp761E2110
  • Gene Description:
  • tigger transposable element derived 6
  • Gene Summary:
  • The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known. [provided by RefSeq
  • Other Designations:
  • hypothetical protein LOC81789
  • RSS
  • YouTube
  • Linkedin
  • Facebook