GRPEL1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in Raw 264.7.
Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in NIH/3T3.
Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in Jurkat.
Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of GRPEL1 expression in transfected 293T cell line (H00080273-T01) by GRPEL1 MaxPab polyclonal antibody.
Lane 1: GRPEL1 transfected lysate(23.87 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GRPEL1 protein.
Immunogen
GRPEL1 (NP_079472.1, 1 a.a. ~ 217 a.a) full-length human protein.
Sequence
MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in Raw 264.7.Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in NIH/3T3.Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in Jurkat.Western Blot (Cell lysate)
GRPEL1 MaxPab polyclonal antibody. Western Blot analysis of GRPEL1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of GRPEL1 expression in transfected 293T cell line (H00080273-T01) by GRPEL1 MaxPab polyclonal antibody.
Lane 1: GRPEL1 transfected lysate(23.87 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GRPEL1
Entrez GeneID
80273GeneBank Accession#
NM_025196.2Protein Accession#
NP_079472.1Gene Name
GRPEL1
Gene Alias
FLJ25609, HMGE
Gene Description
GrpE-like 1, mitochondrial (E. coli)
Omim ID
606173Gene Ontology
HyperlinkGene Summary
O
Other Designations
GrpE-like 1, mitochondrial|GrpE-like protein cochaperone
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com