BCL2L14 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BCL2L14 monoclonal antibody (M01), clone 1F2 Western Blot analysis of BCL2L14 expression in A-549 ( Cat # L025V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCL2L14 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (61.71 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BCL2L14.
Immunogen
BCL2L14 (AAH25778.1, 1 a.a. ~ 327 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (68)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.71 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BCL2L14 monoclonal antibody (M01), clone 1F2 Western Blot analysis of BCL2L14 expression in A-549 ( Cat # L025V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCL2L14 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BCL2L14
Entrez GeneID
79370GeneBank Accession#
BC025778Protein Accession#
AAH25778.1Gene Name
BCL2L14
Gene Alias
BCLG
Gene Description
BCL2-like 14 (apoptosis facilitator)
Omim ID
606126Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq
Other Designations
BCL2-like 14|apoptosis regulator BCL-G
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com