Product Browser

Last updated: 2014/7/7
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR1E purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00064425-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POLR1E protein.
  • Immunogen:
  • POLR1E (NP_071935.1, 1 a.a. ~ 419 a.a) full-length human protein.
  • Sequence:
  • MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • POLR1E MaxPab polyclonal antibody. Western Blot analysis of POLR1E expression in U-2 OS.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POLR1E expression in transfected 293T cell line (H00064425-T01) by POLR1E MaxPab polyclonal antibody.

    Lane 1: PRAF1 transfected lysate(46.09 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • POLR1E
  • Gene Alias:
  • FLJ13390,FLJ13970,PAF53,PRAF1,RP11-405L18.3
  • Gene Description:
  • polymerase (RNA) I polypeptide E, 53kDa
  • Other Designations:
  • OTTHUMP00000021385,RNA polymerase I associated factor 53,polymerase (RNA) I associated factor 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook