CDH23 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CDH23.
Immunogen
CDH23 (NP_071407, 29 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Sequence
PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.57 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDH23
Entrez GeneID
64072GeneBank Accession#
NM_022124Protein Accession#
NP_071407Gene Name
CDH23
Gene Alias
DFNB12, DKFZp434P2350, FLJ00233, FLJ36499, KIAA1774, KIAA1812, MGC102761, USH1D
Gene Description
cadherin-like 23
Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is a large, single-pass transmembrane protein composed of an extracellular domain containing 27 repeats that show significant homology to the cadherin ectodomain. Expressed in the neurosensory epithelium, the protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Two alternative splice variants have been identified that encode different isoforms. Additional variants have been observed but their full-length nature has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000044780|cadherin 23|cadherin related 23|cadherin-23|otocadherin
-
Interactome
-
Disease
-
Publication Reference
-
Recombinant protein of the first two ectodomains of cadherin 23 from erl mice shows impairment in Ca2+-dependent proteolysis protection.
Zhao M, Li P, Xie Y, Liu X, Cheng L, Liu T, Kong L, Wang O, Han F.
Protein Expression and Purification 2018 Feb; 147:55.
Application:WB-Re, E.coli, E.coli competent cells- competent Rosetta (DE3).
-
Cadherin-23 mediates heterotypic cell-cell adhesion between breast cancer epithelial cells and fibroblasts.
Apostolopoulou M, Ligon L.
PLoS One 2012 Mar; 7(3):e33289.
Application:IF, IHC, WB-Ce, WB-Tr, Human, MCF-7 cells, NBFs, Breast.
-
Recombinant protein of the first two ectodomains of cadherin 23 from erl mice shows impairment in Ca2+-dependent proteolysis protection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com