SAV1 monoclonal antibody (M02), clone 3B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SAV1 monoclonal antibody (M02), clone 3B2. Western Blot analysis of SAV1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
SAV1 monoclonal antibody (M02), clone 3B2 Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunoprecipitation
Immunoprecipitation of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAV1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAV1 on HeLa cell. [antibody concentration 60 ug/ml]
Western Blot detection against Immunogen (34.98 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SAV1.
Immunogen
SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.98 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SAV1 monoclonal antibody (M02), clone 3B2. Western Blot analysis of SAV1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
SAV1 monoclonal antibody (M02), clone 3B2 Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAV1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAV1 on HeLa cell. [antibody concentration 60 ug/ml] -
Gene Info — SAV1
Entrez GeneID
60485GeneBank Accession#
NM_021818Protein Accession#
NP_068590Gene Name
SAV1
Gene Alias
SAV, WW45, WWP4
Gene Description
salvador homolog 1 (Drosophila)
Omim ID
607203Gene Ontology
HyperlinkGene Summary
WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a coiled-coil region. It is ubiquitously expressed in adult tissues. The encoded protein is 94% identical to the mouse protein at the amino acid level. [provided by RefSeq
Other Designations
1700040G09Rik|WW domain-containing|WW45 protein
-
Interactome
-
Publication Reference
-
Mammalian Hippo kinase pathway is downregulated by BCL-2 via protein degradation.
Won GW, Park SH, Park J, Lee Y, Lee YH.
Biochemical and Biophysical Research Communications 2019 Apr; 512(1):87.
Application：WB-Tr, Human, HEK 293, SH-SY5Y cells.
-
FGF15 Activates Hippo Signaling to Suppress Bile Acid Metabolism and Liver Tumorigenesis.
Ji S, Liu Q, Zhang S, Chen Q, Wang C, Zhang W, Xiao C, Li Y, Nian C, Li J, Li J, Geng J, Hong L, Xie C, He Y, Chen X, Li X, Yin ZY, You H, Lin KH, Wu Q, Yu C, Johnson RL, Wang L, Chen L, Wang F, Zhou D.
Developmental Cell 2019 Feb; 48(4):460.
Application：WB, Human, Human mammalian cells.
-
Kidney-specific knockout of Sav1 in the mouse promotes hyper-proliferation of renal tubular epithelium through suppression of the Hippo pathway.
Kai T, Tsukamoto Y, Hijiya N, Tokunaga A, Nakada C, Uchida T, Daa T, Iha H, Takahashi M, Nomura T, Sato F, Mimata H, Ikawa M, Seto M, Matsuura K, Moriyama M.
The Journal of Pathology 2016 Mar; 239(1):97.
Application：IF, IHC-P, Mouse, Kidney.
-
Hippo signaling mediates proliferation, invasiveness and metastatic potential of clear cell renal cell carcinoma.
Schutte U, Bisht S, Heukamp LC, Kebschull M, Florin A, Haarmann J, Hoffmann P, Bendas G, Buettner R, Brossart P, Feldmann G.
Translational Oncology 2014 Apr; 7(2):309.
Application：IHC-P, Human, Clear cell renal cell carcinoma.
-
Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system.
Li X, Luo X, Li Z, Wang G, Xiao H, Tao D, Gong J, Hu J.
Molecular Biology Reports 2012 Aug; 39(8):8225.
Application：WB, Yeast, Yeast.
-
Mammalian Ste20-Like Kinase and SAV1 Promote 3T3-L1 Adipocyte Differentiation by Activation of PPARγ.
Park BH, Kim DS, Won GW, Jeon HJ, Oh BC, Lee Y, Kim EG, Lee YH.
PLoS One 2012 Jan; 7(1):e30983.
Application：WB-Ce, Mouse, 3T3-L1 adipocyte.
-
LATS2 Is a Tumor Suppressor Gene of Malignant Mesothelioma.
Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, Akatsuka S, Horio Y, Hida T, Kondo Y, Toyokuni S, Osada H, Sekido Y.
Cancer Research 2011 Feb; 71(3):873.
Application：IF, WB-Ce, Human, Met-5A, NCI-H290, Y-MESO-14, Y-MESO-27, Y-MESO-30 cells.
-
Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
Mardin BR, Lange C, Baxter JE, Hardy T, Scholz SR, Fry AM, Schiebel E.
Nature Cell Biology 2010 Dec; 12(12):1166.
Application：WB-Tr, Human, RPE-1 cells.
-
Mammalian Hippo kinase pathway is downregulated by BCL-2 via protein degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com