- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Binding > Others > EXOC4 monoclonal antibody (M06), clone 4F1
EXOC4 monoclonal antibody (M06), clone 4F1
- Catalog # : H00060412-M06
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant EXOC4.
- Immunogen:
- EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
- Host:
- Mouse
- Reactivity:
- Human, Mouse, Rat
- Isotype:
- IgG2a Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H.Eur J Oral Sci. 2012 Apr;120(2):123-31. doi: 10.1111/j.1600-0722.2012.00952.x.
- Applications
- Western Blot (Cell lysate)
- EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in PC-12(Cat # L012V1 ).
- Protocol Download
- Western Blot (Cell lysate)
- EXOC4 monoclonal antibody (M06), clone 4F1 Western Blot analysis of EXOC4 expression in Hela NE ( Cat # L013V3 ).
- Protocol Download
- Western Blot (Cell lysate)
- EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in Raw 264.7(Cat # L024V1 ).
- Protocol Download
- Western Blot (Cell lysate)
- EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in NIH/3T3(Cat # L018V1 ).
- Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged EXOC4 is approximately 0.1ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 60412
- GeneBank Accession#:
- NM_021807
- Protein Accession#:
- NP_068579
- Gene Name:
- EXOC4
- Gene Alias:
- MGC27170,REC8,SEC8,SEC8L1,Sec8p
- Gene Description:
- exocyst complex component 4
- Omim ID:
- 608185
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
- Other Designations:
- SEC8 protein,SEC8-like 1
- Gene Pathway
