JAM2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human JAM2 protein.
Immunogen
JAM2 (NP_067042.1, 1 a.a. ~ 298 a.a) full-length human protein.
Sequence
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of JAM2 expression in transfected 293T cell line (H00058494-T02) by JAM2 MaxPab polyclonal antibody.
Lane 1: JAM2 transfected lysate(33.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — JAM2
Entrez GeneID
58494GeneBank Accession#
NM_021219.2Protein Accession#
NP_067042.1Gene Name
JAM2
Gene Alias
C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Gene Description
junctional adhesion molecule 2
Omim ID
606870Gene Ontology
HyperlinkGene Summary
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types and may play a role in lymphocyte homing to secondary lymphoid organs. [provided by RefSeq
Other Designations
JAM-IT/VE-JAM|OTTHUMP00000096100|junctional adhesion molecule B|vascular endothelial junction-associated molecule
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com