PCTP monoclonal antibody (M01), clone 1F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PCTP monoclonal antibody (M01), clone 1F9 Western Blot analysis of PCTP expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PCTP expression in transfected 293T cell line by PCTP monoclonal antibody (M01), clone 1F9.
Lane 1: PCTP transfected lysate(24.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCTP is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PCTP over-expressed 293 cell line, cotransfected with PCTP Validated Chimera RNAi ( Cat # H00058488-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCTP monoclonal antibody (M01), clone 1F9 (Cat # H00058488-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (49.28 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PCTP.
Immunogen
PCTP (AAH12084, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCTP monoclonal antibody (M01), clone 1F9 Western Blot analysis of PCTP expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PCTP expression in transfected 293T cell line by PCTP monoclonal antibody (M01), clone 1F9.
Lane 1: PCTP transfected lysate(24.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCTP is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PCTP over-expressed 293 cell line, cotransfected with PCTP Validated Chimera RNAi ( Cat # H00058488-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCTP monoclonal antibody (M01), clone 1F9 (Cat # H00058488-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PCTP
Entrez GeneID
58488GeneBank Accession#
BC012084Protein Accession#
AAH12084Gene Name
PCTP
Gene Alias
STARD2
Gene Description
phosphatidylcholine transfer protein
Omim ID
606055Gene Ontology
HyperlinkOther Designations
START domain containing 2|StAR-related lipid transfer (START) domain containing 2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com