EP400 monoclonal antibody (M01), clone 2A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody (M01), clone 2A7.
Lane 1: EP400 transfected lysate(105.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EP400.
Immunogen
EP400 (NP_056224.2, 743 a.a. ~ 850 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody (M01), clone 2A7.
Lane 1: EP400 transfected lysate(105.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — EP400
Entrez GeneID
57634GeneBank Accession#
NM_015409Protein Accession#
NP_056224.2Gene Name
EP400
Gene Alias
CAGH32, DKFZP434I225, FLJ42018, FLJ45115, P400, TNRC12
Gene Description
E1A binding protein p400
Omim ID
606265Gene Ontology
HyperlinkOther Designations
p400 SWI2/SNF2-related protein|trinucleotide repeat containing 12
-
Interactome
-
Publication Reference
-
Hepatitis C Virus NS3 Protein Can Activate the Notch-Signaling Pathway through Binding to a Transcription Factor, SRCAP.
Iwai A, Takegami T, Shiozaki T, Miyazaki T.
PLoS One 2011 Jun; 6(6):e20718.
Application：WB-Tr, Human, HEK293 cells.
-
Hepatitis C Virus NS3 Protein Can Activate the Notch-Signaling Pathway through Binding to a Transcription Factor, SRCAP.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com