AHRR polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant AHRR.
Immunogen
AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Sequence
RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58); Rat (58)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — AHRR
Entrez GeneID
57491GeneBank Accession#
NM_020731Protein Accession#
NP_065782Gene Name
AHRR
Gene Alias
AHH, AHHR, KIAA1234, MGC167813, MGC176630, bHLHe77
Gene Description
aryl-hydrocarbon receptor repressor
Omim ID
606517Gene Ontology
HyperlinkGene Summary
Dioxin is a teratogen that exerts its effects through the arylhydrocarbon receptor in conjunction with the receptor's binding partner, arylhydrocarbon receptor nuclear translocator. The protein encoded by this gene represses signal transduction by the arylhydrocarbon receptor by competing with the arylhydrocarbon receptor nuclear translocator for binding to the arylhydrocarbon receptor. Expression of the repressor is stimulated by the receptor/translocator heterodimer, thereby regulating receptor function through a negative feedback mechanism. In addition, the encoded protein can bind to nuclear factor kappa-B. [provided by RefSeq
Other Designations
aryl hydrocarbon hydroxylase regulator|aryl hydrocarbon receptor regulator|arylhydrocarbon receptor repressor|dioxin receptor repressor
-
Interactome
-
Disease
-
Publication Reference
-
Role of AHR, AHRR and ARNT in response to dioxin-like PCBs in Spaurus aurata.
Calo M, Licata P, Bitto A, Cascio PL, Interdonato M, Altavilla D.
Environmental Science and Pollution Research International 2014 Dec; 21(24):14226.
Application:IHC, WB-Ti, Fish, Liver.
-
Role of AHR, AHRR and ARNT in response to dioxin-like PCBs in Spaurus aurata.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com