Product Browser

Last updated: 2014/7/28
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDRG2 polyclonal antibody (A01)

  • Catalog # : H00057447-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NDRG2.
  • Immunogen:
  • NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057447-A01
    Western Blot detection against Immunogen (36.67 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NDRG2
  • Gene Alias:
  • DKFZp781G1938,FLJ25522,KIAA1248,SYLD
  • Gene Description:
  • NDRG family member 2
  • Gene Summary:
  • This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • N-myc downstream regulator 2,N-myc downstream-regulated gene 2,NDR1-related protein NDR2,OTTHUMP00000164407,cytoplasmic protein Ndr1,syld709613 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook