CIAPIN1 monoclonal antibody (M01), clone 5G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8. Western Blot analysis of CIAPIN1 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8 Western Blot analysis of CIAPIN1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8. Western Blot analysis of CIAPIN1 expression in PC-12(Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CIAPIN1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.
Immunogen
CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8. Western Blot analysis of CIAPIN1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8 Western Blot analysis of CIAPIN1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
CIAPIN1 monoclonal antibody (M01), clone 5G8. Western Blot analysis of CIAPIN1 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CIAPIN1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — CIAPIN1
Entrez GeneID
57019GeneBank Accession#
NM_020313Protein Accession#
NP_064709Gene Name
CIAPIN1
Gene Alias
2810413N20Rik, Anamorsin, DRE2, PRO0915
Gene Description
cytokine induced apoptosis inhibitor 1
Omim ID
608943Gene Ontology
HyperlinkGene Summary
CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM
Other Designations
OTTHUMP00000164661|predicted protein of HQ0915
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com