C1GALT1 monoclonal antibody (M01), clone 1F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant C1GALT1.
Immunogen
C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C1GALT1 monoclonal antibody (M01), clone 1F1 Western Blot analysis of C1GALT1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C1GALT1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — C1GALT1
Entrez GeneID
56913GeneBank Accession#
NM_020156Protein Accession#
NP_064541Gene Name
C1GALT1
Gene Alias
C1GALT, T-synthase
Gene Description
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Omim ID
610555Gene Ontology
HyperlinkGene Summary
The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins. Core 1 is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R by core 1 beta-3-galactosyltransferase (C1GALT1) (Ju et al., 2002 [PubMed 11677243]).[supplied by OMIM
Other Designations
core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase|core 1 beta3-Gal-T
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Association of cell surface mucins with galectin-3 contributes to the ocular surface epithelial barrier.
Argueso P, Guzman-Aranguez A, Mantelli F, Cao Z, Ricciuto J, Panjwani N.
The Journal of Biological Chemistry 2009 Aug; 284(34):23037.
Application:WB, Human, HCLE cells.
-
Association of cell surface mucins with galectin-3 contributes to the ocular surface epithelial barrier.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com