APOM (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — APOM
Entrez GeneID
55937GeneBank Accession#
BC020683Protein Accession#
AAH20683Gene Name
APOM
Gene Alias
G3a, HSPC336, MGC22400, NG20
Gene Description
apolipoprotein M
Omim ID
606907Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. [provided by RefSeq
Other Designations
NG20-like protein|OTTHUMP00000029364|alternative name: G3a, NG20
-
Interactome
-
Disease
-
Publication Reference
-
ApoM-S1P Modulates Ox-LDL-Induced Inflammation Through the PI3K/Akt Signaling Pathway in HUVECs.
Zheng Z, Zeng Y, Zhu X, Tan Y, Li Y, Li Q, Yi G.
Inflammation 2018 Oct; [Epub].
Application:Func, Human, HUVECs.
-
Apolipoprotein M Gene (APOM) Polymorphism Modifies Metabolic and Disease Traits in Type 2 Diabetes.
Zhou JW, Tsui SK, Ng MC, Geng H, Li SK, So WY, Ma RC, Wang Y, Tao Q, Chen ZY, Chan JC, Ho YY.
PLoS One 2011 Feb; 6(2):e17324.
Application:Dot, As a standard, Recombinant protein.
-
Evaluation of apolipoprotein M as a biomarker of coronary artery disease.
Jiao G, Yang C, Li J, Xiao M, Lin L, Xue Y, Ye Y.
Clinical Biochemistry 2009 Mar; 42(4-5):365.
Application:Quant, Human, Plasma from patients with coronary artery disease.
-
Evaluation of Apolipoprotein M Serum Concentration as a Biomarker of HNF-1alpha MODY.
Skupien J, Kepka G, Gorczynska-Kosiorz S, Gebska A, Klupa T, Wanic K, Nowak N, Borowiec M, Sieradzki J, Malecki MT.
The Review of Diabetic Studies : RDS 2008 Feb; 4(4):231.
Application:Dot, WB-Re.
-
ApoM-S1P Modulates Ox-LDL-Induced Inflammation Through the PI3K/Akt Signaling Pathway in HUVECs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com